PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna32181.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 649aa    MW: 72308.3 Da    PI: 8.7915
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna32181.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding476e-15391438148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WT+eEd +l +++k +G+g W+++ +  g++R++k+c++rw +yl
  mrna32181.1-v1.0-hybrid 391 KGLWTAEEDIILTEYIKVHGKGKWNRVTKVTGLKRCGKSCRLRWMNYL 438
                              678*******************************************97 PP

2Myb_DNA-binding49.41e-15444502148
                              TSSS-HHHHHHHHHHHHHTTTT............-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg............tWktIartmgkgRtlkqcksrwqkyl 48 
                              rg +++eE +l+++++++lG++             W++Ia +++ gRt++q+k++w+++l
  mrna32181.1-v1.0-hybrid 444 RGDFSEEENDLIIRLHNLLGNRpfhhnmksmvpnKWSLIAGRVP-GRTDNQVKNHWNSHL 502
                              899*****************************************.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1103241.26E-11242No hitNo description
SuperFamilySSF502492.03E-1942134IPR012340Nucleic acid-binding, OB-fold
CDDcd057901.23E-3943128No hitNo description
SuperFamilySSF547917.33E-20130211IPR004088K Homology domain, type 1
PfamPF159852.8E-14131179IPR004088K Homology domain, type 1
PROSITE profilePS5129415.482386438IPR017930Myb domain
SuperFamilySSF466891.39E-25388498IPR009057Homeodomain-like
SMARTSM007177.0E-13390440IPR001005SANT/Myb domain
PfamPF002495.0E-13391438IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-21392445IPR009057Homeodomain-like
CDDcd001674.92E-10394438No hitNo description
PROSITE profilePS5129421.305439506IPR017930Myb domain
SMARTSM007178.9E-14443504IPR001005SANT/Myb domain
PfamPF002497.2E-14444502IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-22446506IPR009057Homeodomain-like
CDDcd001672.07E-9447502No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0003723Molecular FunctionRNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 649 aa     Download sequence    Send to blast
MANQTIKLGG GLRQDCDAIA AMKAGTLRFS KPNKYWVETS QKRYVPCVED SVLGIMVDSK  60
ADNFLVDIKG PSLAFLPVLA FEGGTRRNIP KFEVGTLLYV RVVKANPGMN PELSCMDAGG  120
KAAEYGPLKD GYMFECSTGL SRMLLSSPTR PVLAALGKNI SFEIAIGVNG RVWVNATEAD  180
KVIIVANAIM NSEHLSGVQQ IAMVDKLLKK INDLASLRPV LGCDLNKLFD DKALIGNLCS  240
FDHMKVKKVV HGMSESEIRK WTGTAFLEAS AAYSRDRLVV SETKSEILAE VVTNLFRFGF  300
GCPNLITQLL LCFRDWQRKT MTGWAGVGGL GGVRRLSERR VVRARIQASK SNDYDSGNYA  360
TKGRAWERGK SGNWVLAAVM EDGGRNHGYK KGLWTAEEDI ILTEYIKVHG KGKWNRVTKV  420
TGLKRCGKSC RLRWMNYLSP TVKRGDFSEE ENDLIIRLHN LLGNRPFHHN MKSMVPNKWS  480
LIAGRVPGRT DNQVKNHWNS HLSKKLGVKS KAKNRSRRSH SSSTTTSDQQ ASPKEKFNTA  540
ELQQQPLPDD SNGGGYGEAA AQGGHGCDDD HEQEMMIISR DSDVEFSGMW ETMMMGSNND  600
YDHQGSFWLY NNNEDDLNLS NPNYFMDPSL DHHHLHDYSF EFLEDIGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2nn6_G2e-37620779286Exosome complex exonuclease RRP40
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ4390585e-34KJ439058.1 Geum reptans clone Geumrep_002235 microsatellite sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.14e-57myb domain protein 66